Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG532800.1.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 704aa    MW: 76510.3 Da    PI: 6.292
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG532800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
                         688999***********************************************998 PP

                START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                          +a +a++el+++a+a++++W + +     e +n d++ ++f++ ++       ++e +r+sg+v+m +  lv  ++d++ +W e ++   
                          5789********************999999999999999997766699*******************************.********** PP

                START  78 .kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepks 158
                            a t++v+ +g     g l+lm+ el ++sp+vp R+  f+Ry+rq + g w+i+dvSvd + +          R+ +lpSg+li +++
                          9************************************************************9999887432..357779*********** PP

                START 159 nghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          ng+skvtwveh+++++r+p h l+r l+ sg+a+ga +w+a+lqr ce+
                          ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.8151474IPR001356Homeobox domain
SMARTSM003891.6E-191578IPR001356Homeobox domain
CDDcd000861.24E-191675No hitNo description
PfamPF000462.0E-181772IPR001356Homeobox domain
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
PROSITE profilePS5084844.182206444IPR002913START domain
SuperFamilySSF559612.03E-32207442No hitNo description
CDDcd088755.82E-108210440No hitNo description
SMARTSM002348.0E-39215441IPR002913START domain
PfamPF018523.5E-40216441IPR002913START domain
Gene3DG3DSA:3.30.530.209.6E-5323411IPR023393START-like domain
SuperFamilySSF559611.22E-19459695No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954072.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLK3YQE00.0K3YQE0_SETIT; Uncharacterized protein
STRINGSi016483m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11